| Title: | Recipes for Data Visualization |
|---|---|
| Description: | A collection of custom 'ggplot2'-based visualizations for data exploration and analysis. Each function handles data preprocessing and returns a object that can be further customized using standard 'ggplot2' syntax. |
| Authors: | Ignophi Hu [aut, cre, cph] (ORCID: <https://orcid.org/0009-0002-4094-0868>) |
| Maintainer: | Ignophi Hu <[email protected]> |
| License: | MIT + file LICENSE |
| Version: | 0.1.0 |
| Built: | 2026-05-22 08:05:41 UTC |
| Source: | https://github.com/ignophi/ggrecipes |
Creates a barplot visualization of biodistribution data (e.g., %ID/g across organs) with optional separation of specific organs onto free y-scales to prevent squishing of lower values. Points are overlaid on bars and all facets are displayed in a single row.
The function accepts:
Long data: value is the name of the numeric column containing
the measurements (original behaviour).
Wide data: value is a regular expression pattern that matches
the measurement columns (e.g. "_val$" for Blood_val,
Liver_val, etc.). In this case, the data are internally converted
to long format, creating a column named by id for organ/tissue and
a column named by value for the measurements.
gg_biodist( data, id = "id", value = "value", y_label = value, group = NULL, separate = NULL, fill_colors = NULL, bar_alpha = 0.7, point_size = 1.5, stat_summary = "mean", error_bars = FALSE, quiet = FALSE )gg_biodist( data, id = "id", value = "value", y_label = value, group = NULL, separate = NULL, fill_colors = NULL, bar_alpha = 0.7, point_size = 1.5, stat_summary = "mean", error_bars = FALSE, quiet = FALSE )
data |
A data frame containing biodistribution measurements. |
id |
Character string specifying the column name in |
value |
Character string specifying either: (1) the column name in
|
y_label |
Character string specifying the label to use for the y-axis.
Default is the same as |
group |
Character string specifying the column name in |
separate |
Character vector of organ/tissue names (matching values in
the |
fill_colors |
Character vector of colors used to fill bars and points.
If |
bar_alpha |
Numeric value (0-1) specifying transparency of bars. Default is 0.7. |
point_size |
Numeric value specifying size of points. Default is 1.5. If set to 0, points are not drawn. |
stat_summary |
Character string specifying summary statistic for bars.
One of |
error_bars |
Logical indicating whether to add error bars (mean ± SD). Default is FALSE. |
quiet |
Logical indicating whether to suppress messages during data processing (e.g., when coercing non-numeric columns to numeric). Default is FALSE. |
The function automatically handles both long and wide format data:
Long format: Each row represents one measurement with columns for organ ID and value
Wide format: Each row represents one sample/replicate with separate columns for each organ (detected via regex pattern)
When separate is specified, high-uptake organs are displayed in
separate facets with independent y-axis scales, preventing compression of
lower values in the main plot.
A ggplot2 object showing the biodistribution as barplot with points. The plot displays:
Bars representing summary statistics (mean or median) for each organ
Individual data points overlaid on bars
Optional grouping with dodged bars and colored by group
Optional separation of high-uptake organs onto independent y-scales
Optional error bars showing standard deviation
bio_data <- data.frame( id = paste0("sample_", 1:6), condition = rep(c("Control", "Treated"), each = 3), replicate = rep(1:3, times = 2), Blood_val = c(4.8, 5.2, 4.5, 4.1, 4.3, 4.0), Heart_val = c(1.9, 2.1, 2.0, 1.6, 1.8, 1.7), Lung_val = c(3.5, 3.8, 3.2, 3.0, 3.1, 2.9), Liver_val = c(14.2, 15.1, 13.8, 11.5, 12.0, 11.2), Spleen_val = c(9.1, 8.7, 9.4, 7.2, 7.5, 7.0), Kidney_val = c(125.0, 112.8, 121.9, 111.1, 102.4, 103.0), Tumor_val = c(22.5, 24.1, 23.3, 28.2, 29.5, 27.8), Muscle_val = c(0.7, 0.6, 0.8, 0.5, 0.4, 0.6), Bone_val = c(1.4, 1.6, 1.5, 1.1, 1.2, 1.0) ) # Base biodist plot gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 1.25, y_label = "%ID/g") # Separate high uptake organs on separate axis gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 1.25, y_label = "%ID/g", separate = c("Tumor", "Kidney")) # Customization gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 0, error_bars = TRUE, fill_colors = c("#e41a1c", "#377eb8"), y_label = "%ID/g", separate = c("Tumor", "Kidney"))bio_data <- data.frame( id = paste0("sample_", 1:6), condition = rep(c("Control", "Treated"), each = 3), replicate = rep(1:3, times = 2), Blood_val = c(4.8, 5.2, 4.5, 4.1, 4.3, 4.0), Heart_val = c(1.9, 2.1, 2.0, 1.6, 1.8, 1.7), Lung_val = c(3.5, 3.8, 3.2, 3.0, 3.1, 2.9), Liver_val = c(14.2, 15.1, 13.8, 11.5, 12.0, 11.2), Spleen_val = c(9.1, 8.7, 9.4, 7.2, 7.5, 7.0), Kidney_val = c(125.0, 112.8, 121.9, 111.1, 102.4, 103.0), Tumor_val = c(22.5, 24.1, 23.3, 28.2, 29.5, 27.8), Muscle_val = c(0.7, 0.6, 0.8, 0.5, 0.4, 0.6), Bone_val = c(1.4, 1.6, 1.5, 1.1, 1.2, 1.0) ) # Base biodist plot gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 1.25, y_label = "%ID/g") # Separate high uptake organs on separate axis gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 1.25, y_label = "%ID/g", separate = c("Tumor", "Kidney")) # Customization gg_biodist(bio_data, id = "organ", value = "_val", group = "condition", point_size = 0, error_bars = TRUE, fill_colors = c("#e41a1c", "#377eb8"), y_label = "%ID/g", separate = c("Tumor", "Kidney"))
The function automatically computes frequency counts for each unique
combination of the x and y categorical variables using table().
Bubble sizes are scaled proportionally to represent counts, with the
range controlled by point_size_range. Useful for visualizing
cross-tabulations, confusion matrices, or any bivariate categorical data.
gg_conf( data, x, y, fill = "skyblue", text_size = 4, text_color = "black", point_size_range = c(3, 15), border_color = "black", show_grid = TRUE, expand = 0.15, facet_x = NULL, facet_y = NULL )gg_conf( data, x, y, fill = "skyblue", text_size = 4, text_color = "black", point_size_range = c(3, 15), border_color = "black", show_grid = TRUE, expand = 0.15, facet_x = NULL, facet_y = NULL )
data |
A data frame containing the categorical variables. |
x |
Character string specifying the column name in |
y |
Character string specifying the column name in |
fill |
Character string specifying the fill color for bubbles. Default is "skyblue". |
text_size |
Numeric value specifying the size of count labels. Default is 4. |
text_color |
Character string specifying the color of count labels. Default is "black". |
point_size_range |
Numeric vector of length 2 specifying the minimum
and maximum bubble sizes. Default is |
border_color |
Character string specifying the color of bubble borders. Default is "black". |
show_grid |
Logical indicating whether to show major grid lines. Default is TRUE. |
expand |
Numeric value specifying the expansion multiplier for both axes. Default is 0.15. |
facet_x |
Character string specifying an optional column name in
|
facet_y |
Character string specifying an optional column name in
|
A ggplot2 object showing the confusion table as a bubble plot. The plot displays:
Bubbles at each x-y combination, sized by frequency count
Count labels displayed in the center of each bubble
Optional faceting for additional categorical variables
Customizable colors, sizes, and grid visibility
data(mtcars) # Create synthetic categorical variables # Bin horsepower & fuel efficiency into ordered categories mtcars$horsepower <- cut(mtcars$hp, breaks = 5, labels = c("Very Low", "Low", "Medium", "High", "Very High")) mtcars$`miles per gallon` <- cut(mtcars$mpg, breaks = 5, labels = c("Very Low", "Low", "Medium", "High", "Very High")) # Base plot gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon") # Custom styling gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon", fill = "lightcoral", point_size_range = c(5, 20), show_grid = FALSE) # With faceting by "vs" column gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon", fill = "lightcoral", point_size_range = c(5, 20), facet_x = "vs", show_grid = FALSE)data(mtcars) # Create synthetic categorical variables # Bin horsepower & fuel efficiency into ordered categories mtcars$horsepower <- cut(mtcars$hp, breaks = 5, labels = c("Very Low", "Low", "Medium", "High", "Very High")) mtcars$`miles per gallon` <- cut(mtcars$mpg, breaks = 5, labels = c("Very Low", "Low", "Medium", "High", "Very High")) # Base plot gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon") # Custom styling gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon", fill = "lightcoral", point_size_range = c(5, 20), show_grid = FALSE) # With faceting by "vs" column gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon", fill = "lightcoral", point_size_range = c(5, 20), facet_x = "vs", show_grid = FALSE)
Creates a tile-based heatmap visualization where samples are displayed on the y-axis and criteria are shown on the x-axis. Each tile shows a criterion value with color coding. Optional barplots can be added to the right side to display numeric metrics for each sample.
gg_criteria( data, id = "id", criteria = "_criteria", bar_column = NULL, bar_fill = NULL, panel_ratio = 0.3, tile_width = 0.7, tile_height = 0.7, tile_alpha = 1, tile_fill = NULL, show_text = TRUE, border_color = "black", border_width = 0.5, text_size = 8, show_legend = TRUE, quiet = FALSE )gg_criteria( data, id = "id", criteria = "_criteria", bar_column = NULL, bar_fill = NULL, panel_ratio = 0.3, tile_width = 0.7, tile_height = 0.7, tile_alpha = 1, tile_fill = NULL, show_text = TRUE, border_color = "black", border_width = 0.5, text_size = 8, show_legend = TRUE, quiet = FALSE )
data |
A data frame containing the data to visualize. |
id |
Character string specifying the column name in |
criteria |
Character string specifying either: (1) the column name in
|
bar_column |
Character vector specifying column name(s) in |
bar_fill |
Character vector specifying the fill color(s) for bars.
When |
panel_ratio |
Numeric value specifying the total relative width of the
barplot panel(s) compared to the heatmap panel (which has a reference
width of 1). When multiple |
tile_width |
Numeric value (0-1) specifying the width of tiles as a proportion of available space. Default is 0.7. |
tile_height |
Numeric value (0-1) specifying the height of tiles as a proportion of available space. Default is 0.7. |
tile_alpha |
Numeric value (0-1) specifying transparency of tiles. Default is 1 (fully opaque). |
tile_fill |
Named character vector of colors for criterion values
(e.g., |
show_text |
Logical indicating whether to show criterion values as text labels on tiles. Default is TRUE. |
border_color |
Character string specifying the color of tile borders. Default is "black". |
border_width |
Numeric value specifying the width of tile borders. Default is 0.5. |
text_size |
Numeric value specifying the size of axis text. Default is 8. |
show_legend |
Logical indicating whether to show the fill legend. Default is TRUE. |
quiet |
Logical indicating whether to suppress messages. Default is FALSE. |
The function currently supports wide format data where each criterion is a
separate column. The column names should match the pattern specified in
criteria (e.g., columns ending in "_crit"). The pattern is removed
from column names to create criterion labels.
When bar_column is specified, horizontal barplots are added to the
right side of the heatmap. Multiple barplots can be created by providing a
vector of column names. Each barplot shows the numeric values with text
labels positioned outside the bars.
The function calculates and suggests plot dimensions based on the number of
samples and criteria. Access these via attr(plot, "recommended_dims").
WARNING: Alignment between heatmap and barplots depends on plot dimensions.
The function provides recommended dimensions (accessible via
attr(plot, "recommended_dims")) that ensure proper alignment. You
can adjust these dimensions to improve appearance (e.g., reduce width to
tighten spacing, or scale proportionally for size) while maintaining
alignment.
A ggplot2 object (or patchwork object if bar_column is used)
showing the criteria heatmap. The plot displays:
Tiles at each sample-criterion intersection
Tile colors indicating criterion values
Criterion values as text labels within tiles
Optional horizontal barplots on the right side
A "recommended_dims" attribute with suggested width and height in inches
# Example: Gene prioritization criteria gene_data <- data.frame( gene = c("BRCA1", "TP53", "EGFR", "KRAS", "MYC", "PTEN", "APC", "CDKN2A", "RB1", "VHL"), `Missense Variant_crit` = c("Yes", "Yes", "Yes", NA, "Yes", "Yes", NA, "Yes", NA, "Yes"), `eQTL_crit` = c("Yes", "Yes", NA, "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", NA), `pQTL_crit` = c("Yes", NA, "Yes", "Yes", NA, "Yes", "Yes", NA, "Yes", "Yes"), `GWAS Hit_crit` = c("Yes", "Yes", "Yes", "Yes", NA, "Yes", "Yes", "Yes", NA, NA), `Loss of Function_crit` = c(NA, "Yes", NA, NA, "Yes", "Yes", "Yes", NA, "Yes", NA), `High Conservation_crit` = c("Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes"), `mRNA DE_crit` = c("Yes", NA, "Yes", NA, NA, "Yes", "Yes", "Yes", NA, "Yes"), `Prot DE_crit` = c(NA, "Yes", NA, NA, NA, "Yes", NA, NA, NA, "Yes"), check.names = FALSE ) # Calculate total criteria met crit_cols <- grep("_crit$", names(gene_data), value = TRUE) gene_data$`Total` <- rowSums(gene_data[crit_cols] == "Yes", na.rm = TRUE) # Base criteria plot # **Warn**: space between heatmap and barplots depends on plot width gg_criteria( data = gene_data, id = "gene", criteria = "_crit$", bar_column = "Total", show_text = FALSE, tile_fill = c(Yes = "#A6CEE3", No = "white"), bar_fill = "#A6CEE3", panel_ratio = 1 ) # Example: VHH Variant Analysis # Define amino acid chemistry colors aa_colors <- c( "D" = "#E60A0A", "E" = "#E60A0A", # Acidic (red) "K" = "#145AFF", "R" = "#145AFF", # Basic (blue) "H" = "#8282D2", # Histidine (purple) "S" = "#FA9600", "T" = "#FA9600", # Polar uncharged (orange) "N" = "#00DCDC", "Q" = "#00DCDC", # Polar amides (cyan) "C" = "#E6E600", # Cysteine (yellow) "G" = "#EBEBEB", # Glycine (light gray) "P" = "#DC9682", # Proline (tan) "A" = "#C8C8C8", # Alanine (gray) "V" = "#0F820F", "I" = "#0F820F", # Hydrophobic (green) "L" = "#0F820F", "M" = "#0F820F", "F" = "#3232AA", "W" = "#B45AB4", # Aromatic (dark blue/purple) "Y" = "#3232AA" ) vhh_variants <- data.frame( variant = c("WT", "Mut1", "Mut2", "Mut3", "Mut4", "Mut7", "Mut5", "Mut6", "Mut8", "Mut9", "Mut10", "Mut11"), Q5_mut = c(NA, "H", NA, NA, NA, NA, "H", "H", "H", "D", NA, "H"), S55_mut = c(NA, NA, "P", NA, NA, "P", "P", NA, "P", "P", NA, NA), N73_mut = c(NA, NA, NA, "E", NA, NA, NA, "E", "E", NA, "E", NA), K80_mut = c(NA, "L", NA, NA, "S", "V", NA, NA, NA, "L", "S", NA), F99_mut = c(NA, NA, "L", NA, NA, NA, NA, NA, NA, "W", NA, "W"), KD_nM = c(45, 18, 5.2, 38, 42, 20, 3.8, 15, 3.2, 4.5, 40, 22), yield_mg_L = c(12, 11.8, 10, 13, 11, 10, 10, 12, 10, 7.8, 12.5, 8.5), Tm_C = c(68.5, 67.8, 68, 72.3, 35, 66, 67.5, 70, 70.5, 72, 38, 74) ) # Create the systematic variant heatmap gg_criteria( data = vhh_variants, id = "variant", criteria = "_mut$", tile_fill = aa_colors, bar_column = c("KD_nM", "yield_mg_L", "Tm_C"), panel_ratio = 2, tile_width = 0.70, tile_height = 0.70, show_text = TRUE, border_color = "grey40", border_width = 0.4, text_size = 10, show_legend = FALSE )# Example: Gene prioritization criteria gene_data <- data.frame( gene = c("BRCA1", "TP53", "EGFR", "KRAS", "MYC", "PTEN", "APC", "CDKN2A", "RB1", "VHL"), `Missense Variant_crit` = c("Yes", "Yes", "Yes", NA, "Yes", "Yes", NA, "Yes", NA, "Yes"), `eQTL_crit` = c("Yes", "Yes", NA, "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", NA), `pQTL_crit` = c("Yes", NA, "Yes", "Yes", NA, "Yes", "Yes", NA, "Yes", "Yes"), `GWAS Hit_crit` = c("Yes", "Yes", "Yes", "Yes", NA, "Yes", "Yes", "Yes", NA, NA), `Loss of Function_crit` = c(NA, "Yes", NA, NA, "Yes", "Yes", "Yes", NA, "Yes", NA), `High Conservation_crit` = c("Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes", "Yes"), `mRNA DE_crit` = c("Yes", NA, "Yes", NA, NA, "Yes", "Yes", "Yes", NA, "Yes"), `Prot DE_crit` = c(NA, "Yes", NA, NA, NA, "Yes", NA, NA, NA, "Yes"), check.names = FALSE ) # Calculate total criteria met crit_cols <- grep("_crit$", names(gene_data), value = TRUE) gene_data$`Total` <- rowSums(gene_data[crit_cols] == "Yes", na.rm = TRUE) # Base criteria plot # **Warn**: space between heatmap and barplots depends on plot width gg_criteria( data = gene_data, id = "gene", criteria = "_crit$", bar_column = "Total", show_text = FALSE, tile_fill = c(Yes = "#A6CEE3", No = "white"), bar_fill = "#A6CEE3", panel_ratio = 1 ) # Example: VHH Variant Analysis # Define amino acid chemistry colors aa_colors <- c( "D" = "#E60A0A", "E" = "#E60A0A", # Acidic (red) "K" = "#145AFF", "R" = "#145AFF", # Basic (blue) "H" = "#8282D2", # Histidine (purple) "S" = "#FA9600", "T" = "#FA9600", # Polar uncharged (orange) "N" = "#00DCDC", "Q" = "#00DCDC", # Polar amides (cyan) "C" = "#E6E600", # Cysteine (yellow) "G" = "#EBEBEB", # Glycine (light gray) "P" = "#DC9682", # Proline (tan) "A" = "#C8C8C8", # Alanine (gray) "V" = "#0F820F", "I" = "#0F820F", # Hydrophobic (green) "L" = "#0F820F", "M" = "#0F820F", "F" = "#3232AA", "W" = "#B45AB4", # Aromatic (dark blue/purple) "Y" = "#3232AA" ) vhh_variants <- data.frame( variant = c("WT", "Mut1", "Mut2", "Mut3", "Mut4", "Mut7", "Mut5", "Mut6", "Mut8", "Mut9", "Mut10", "Mut11"), Q5_mut = c(NA, "H", NA, NA, NA, NA, "H", "H", "H", "D", NA, "H"), S55_mut = c(NA, NA, "P", NA, NA, "P", "P", NA, "P", "P", NA, NA), N73_mut = c(NA, NA, NA, "E", NA, NA, NA, "E", "E", NA, "E", NA), K80_mut = c(NA, "L", NA, NA, "S", "V", NA, NA, NA, "L", "S", NA), F99_mut = c(NA, NA, "L", NA, NA, NA, NA, NA, NA, "W", NA, "W"), KD_nM = c(45, 18, 5.2, 38, 42, 20, 3.8, 15, 3.2, 4.5, 40, 22), yield_mg_L = c(12, 11.8, 10, 13, 11, 10, 10, 12, 10, 7.8, 12.5, 8.5), Tm_C = c(68.5, 67.8, 68, 72.3, 35, 66, 67.5, 70, 70.5, 72, 38, 74) ) # Create the systematic variant heatmap gg_criteria( data = vhh_variants, id = "variant", criteria = "_mut$", tile_fill = aa_colors, bar_column = c("KD_nM", "yield_mg_L", "Tm_C"), panel_ratio = 2, tile_width = 0.70, tile_height = 0.70, show_text = TRUE, border_color = "grey40", border_width = 0.4, text_size = 10, show_legend = FALSE )
Creates a heatmap visualization of biallelic genotypes (e.g., SNPs, variants) with split-tile representation showing phased or unphased alleles. Each tile is divided diagonally to display both alleles, with border color indicating phasing status (black for phased, white for unphased). Optional barplots can be added to display associated numeric data.
gg_geno( data, id = "id", geno = "_geno", bar_column = NULL, bar_fill = NULL, panel_ratio = 0.3, tile_fill = NULL, tile_width = 0.7, tile_height = 0.7, border_width = 0.5, text_size = 10, show_legend = TRUE, quiet = FALSE )gg_geno( data, id = "id", geno = "_geno", bar_column = NULL, bar_fill = NULL, panel_ratio = 0.3, tile_fill = NULL, tile_width = 0.7, tile_height = 0.7, border_width = 0.5, text_size = 10, show_legend = TRUE, quiet = FALSE )
data |
A data frame containing the data to visualize. |
id |
Character string specifying the column name in |
geno |
Character string specifying the regular expression pattern that
identifies genotype columns (e.g., |
bar_column |
Character vector specifying column name(s) in |
bar_fill |
Character vector specifying the fill color(s) for bars.
When |
panel_ratio |
Numeric value specifying the total relative width of the
barplot panel(s) compared to the heatmap panel (which has a reference
width of 1). When multiple |
tile_fill |
Named character vector of colors for criterion values
(e.g., |
tile_width |
Numeric value (0-1) specifying the width of tiles as a proportion of available space. Default is 0.7. |
tile_height |
Numeric value (0-1) specifying the height of tiles as a proportion of available space. Default is 0.7. |
border_width |
Numeric value specifying the width of tile borders. Default is 0.5. |
text_size |
Numeric value specifying the size of axis text. Default is 8. |
show_legend |
Logical indicating whether to show the fill legend. Default is TRUE. |
quiet |
Logical indicating whether to suppress messages. Default is FALSE. |
The function expects genotype data in wide format with:
One column for sample IDs (specified by id)
Multiple columns matching the geno pattern, each representing
a SNP/variant
Genotypes encoded as "allele1/allele2" (unphased) or "allele1|allele2" (phased)
Genotype format examples:
Unphased: "0/0", "0/1", "1/1"
Phased: "0|0", "0|1", "1|0"
Each genotype tile is split diagonally with the first allele in the top-left triangle and the second allele in the bottom-right triangle. The border color indicates phasing: black borders for phased genotypes (|) and white borders for unphased genotypes (/).
When bar_column is specified, the function requires the patchwork
package to combine the heatmap with barplots. Barplots are added to the
right of the heatmap and display numeric values with text labels.
WARNING: Alignment between heatmap and barplots depends on plot dimensions.
The function provides recommended dimensions (accessible via
attr(plot, "recommended_dims")) that ensure proper alignment. You
can adjust these dimensions to improve appearance (e.g., reduce width to
tighten spacing, or scale proportionally for size) while maintaining
alignment.
A ggplot2 object (or patchwork object if bar_column is
specified). The plot displays:
Split tiles representing biallelic genotypes
Top-left triangle: first allele
Bottom-right triangle: second allele
Black borders: phased genotypes (separator: |)
White borders: unphased genotypes (separator: /)
Optional barplots showing numeric data for each sample
Color legend mapping alleles to colors
The returned object has an attribute "recommended_dims" containing
suggested plot width and height in inches.
# Create example SNP and phenotype data set.seed(123) snp_data <- data.frame( id = paste0("P", sprintf("%03d", 1:12)), # SNP columns rs1234_geno = sample(c(c("0/0", "0/1", "1/1"), NA), 12, replace = TRUE, prob = c(0.4, 0.4, 0.15, 0.05)), rs5678_geno = sample(c("0/0", "0/1", "0/2", "1/1", "1/2", "2/2", NA), 12, replace = TRUE, prob = c(0.25, 0.25, 0.1, 0.15, 0.15, 0.05, 0.05)), rs9012_geno = sample(c(c("0|0", "0|1", "1|1", "0/1", "1/2"), NA), 12, replace = TRUE, prob = c(0.2, 0.2, 0.15, 0.2, 0.15, 0.1)), rs3456_geno = sample(c(c("0/0", "0/1", "1/1"), NA), 12, replace = TRUE, prob = c(0.45, 0.35, 0.15, 0.05)), rs7890_geno = sample(c("0/0", "0/1", "0/2", "1/3", "2/2", NA), 12, replace = TRUE, prob = c(0.3, 0.25, 0.15, 0.1, 0.15, 0.05)), rs2468_geno = sample(c("0|0", "0|1", "1|1", "1|2", NA), 12, replace = TRUE, prob = c(0.3, 0.35, 0.2, 0.1, 0.05)), # Phenotype columns for bar plots Age = sample(25:75, 12, replace = TRUE), BMI = round(rnorm(12, mean = 26, sd = 4), 1), Insulin = round(rnorm(12, mean = 12, sd = 3), 1) ) # Base genotype plot gg_geno( data = snp_data, id = "id", geno = "_geno$" ) # Show optional barplots gg_geno( data = snp_data, id = "id", geno = "_geno$", show_legend = TRUE, panel_ratio = 1, bar_column = c("Age", "BMI", "Insulin"), bar_fill = c("#c77d77", "#e0b46e", "#c7bc77"), text_size = 10 )# Create example SNP and phenotype data set.seed(123) snp_data <- data.frame( id = paste0("P", sprintf("%03d", 1:12)), # SNP columns rs1234_geno = sample(c(c("0/0", "0/1", "1/1"), NA), 12, replace = TRUE, prob = c(0.4, 0.4, 0.15, 0.05)), rs5678_geno = sample(c("0/0", "0/1", "0/2", "1/1", "1/2", "2/2", NA), 12, replace = TRUE, prob = c(0.25, 0.25, 0.1, 0.15, 0.15, 0.05, 0.05)), rs9012_geno = sample(c(c("0|0", "0|1", "1|1", "0/1", "1/2"), NA), 12, replace = TRUE, prob = c(0.2, 0.2, 0.15, 0.2, 0.15, 0.1)), rs3456_geno = sample(c(c("0/0", "0/1", "1/1"), NA), 12, replace = TRUE, prob = c(0.45, 0.35, 0.15, 0.05)), rs7890_geno = sample(c("0/0", "0/1", "0/2", "1/3", "2/2", NA), 12, replace = TRUE, prob = c(0.3, 0.25, 0.15, 0.1, 0.15, 0.05)), rs2468_geno = sample(c("0|0", "0|1", "1|1", "1|2", NA), 12, replace = TRUE, prob = c(0.3, 0.35, 0.2, 0.1, 0.05)), # Phenotype columns for bar plots Age = sample(25:75, 12, replace = TRUE), BMI = round(rnorm(12, mean = 26, sd = 4), 1), Insulin = round(rnorm(12, mean = 12, sd = 3), 1) ) # Base genotype plot gg_geno( data = snp_data, id = "id", geno = "_geno$" ) # Show optional barplots gg_geno( data = snp_data, id = "id", geno = "_geno$", show_legend = TRUE, panel_ratio = 1, bar_column = c("Age", "BMI", "Insulin"), bar_fill = c("#c77d77", "#e0b46e", "#c7bc77"), text_size = 10 )
Generates a log-log plot of association rate (ka) vs dissociation rate (kd) with iso-affinity (KD) lines. Useful for visualizing kinetic binding data from surface plasmon resonance (SPR), biolayer interferometry (BLI), or other biophysical assays.
gg_kdmap( data, id = "id", ka = "ka", kd = "kd", labels = NULL, size = 4, shape = 21, fill = "grey", color = "black", ref_id = NULL, ref_shape = 21, ref_color = "black", ref_fill = "white", ref_size = size, rep_lines = TRUE, iso_color = "black", iso_alpha = 1, iso_width = 0.3, iso_type = "dashed", iso_n = 8, text_padding = 1, title = NULL, show_anno = FALSE )gg_kdmap( data, id = "id", ka = "ka", kd = "kd", labels = NULL, size = 4, shape = 21, fill = "grey", color = "black", ref_id = NULL, ref_shape = 21, ref_color = "black", ref_fill = "white", ref_size = size, rep_lines = TRUE, iso_color = "black", iso_alpha = 1, iso_width = 0.3, iso_type = "dashed", iso_n = 8, text_padding = 1, title = NULL, show_anno = FALSE )
data |
A data frame containing kinetic data. Must include columns
specified by the |
id |
Character string specifying the column name in |
ka |
Character string specifying the column name in |
kd |
Character string specifying the column name in |
labels |
Character string specifying a column name in |
size |
Numeric value for point size, or character string specifying
a column name in |
shape |
Numeric value (0-25) for point shape, or character string
specifying a column name in |
fill |
Character string specifying a color for point fill, or a column
name in |
color |
Character string specifying a color for point border, or a
column name in |
ref_id |
Character string specifying the ID of a reference point to
highlight with different aesthetics. Must match a value in the column
specified by |
ref_shape |
Numeric value (0-25) specifying the shape for the reference point. Default is 21. |
ref_color |
Character string specifying the border color for the reference point. Default is "black". |
ref_fill |
Character string specifying the fill color for the reference point. Default is "white". |
ref_size |
Numeric value specifying the size for the reference point.
Default is the value of the |
rep_lines |
Logical indicating whether to connect replicate points (points with the same ID) with lines. Default is TRUE. |
iso_color |
Character string specifying the color of iso-KD lines. Default is "black". |
iso_alpha |
Numeric value (0-1) specifying the transparency of iso-KD lines. Default is 1. |
iso_width |
Numeric value specifying the line width of iso-KD lines. Default is 0.3. |
iso_type |
Character string specifying the line type of iso-KD lines. Must be one of "solid", "dashed", "dotted", "dotdash", "longdash", or "twodash". Default is "dashed". |
iso_n |
Numeric value specifying the number of iso-KD lines to draw, spaced evenly in log10(KD) across the current plot range. Default is 8. |
text_padding |
Numeric value specifying the padding around text labels
when |
title |
Character string for the plot title. If NULL (default), no title is displayed. |
show_anno |
Logical indicating whether to show corner annotations indicating fast on-rate (top left) and fast off-rate (bottom right) regions. Default is FALSE. |
The function creates a log-log plot with:
X-axis: dissociation rate (kd, in s^-1)
Y-axis: association rate (ka, in M^-1s^-1)
Diagonal lines representing iso-affinity contours (constant KD values)
Required units:
ka: M^-1s^-1 (association rate constant)
kd: s^-1 (dissociation rate constant)
The function calculates equilibrium dissociation constant as KD = kd/ka and automatically converts to the most appropriate units (pM, nM, µM, or mM) for display on secondary axes.
Iso-KD lines are generated so that there are always iso_n lines spanning
the visible plot window. They are equally spaced in log10(KD) across the
KD range implied by the current x/y limits. The top (x) and right (y)
secondary axes are labeled with the KD values corresponding to these lines.
A ggplot2 object showing the kinetic rate map. The plot displays:
X-axis: dissociation rate (kd) in s^-1 on log scale
Y-axis: association rate (ka) in M^-1s^-1 on log scale
Points representing individual kinetic measurements
Diagonal iso-affinity lines representing constant KD values
Secondary axes (top and right) showing KD values in appropriate units (pM, nM, µM, or mM)
Optional connecting lines between replicates (same ID)
Optional highlighted reference point
Optional text labels for points
Optional corner annotations indicating rate directions
KD values are automatically calculated from ka and kd rates and displayed in the most appropriate units based on the data range.
geom_point for point customization,
geom_text_repel for label placement.
# Basic example: 5 variants with single measurements kinetic_data <- data.frame( id = c("WT", "Mut1", "Mut2", "Mut3", "Mut4"), ka = c(1.2e5, 2.5e5, 2e5, 8.0e4, 1.8e5), kd = c(1.5e-3, 2.0e-3, 1.5e-3, 1.2e-3, 1.8e-3) ) gg_kdmap(data = kinetic_data, show_anno = TRUE) # With replicates: lines connect points with same ID kinetic_rep <- data.frame( id = c("WT", "WT", "WT", "Mut1", "Mut1", "Mut2", "Mut3", "Mut4"), ka = c(1.2e5, 1.5e5, 1.1e5, 2.5e5, 2.4e5, 2e5, 8.0e4, 1.8e5), kd = c(1.5e-3, 1.6e-3, 1.4e-3, 2.0e-3, 1.9e-3, 1.5e-3, 1.2e-3, 1.8e-3) ) gg_kdmap(data = kinetic_rep, show_anno = TRUE, fill = "id") # Add labels and highlight reference gg_kdmap( data = kinetic_rep, labels = "id", ref_id = "WT", ref_fill = "white", ref_color = "red", fill = "id" ) # Customize iso-KD lines gg_kdmap( data = kinetic_rep, iso_n = 12, iso_color = "#7192ad", iso_type = "solid" ) # Turn off replicate lines gg_kdmap(data = kinetic_rep, rep_lines = FALSE) # Custom column names custom_data <- data.frame( sample = c("WT", "Mut1", "Mut2"), kon = c(1.2e5, 2.5e5, 5.0e4), koff = c(1.5e-3, 2.0e-3, 5.0e-4) ) gg_kdmap(data = custom_data, id = "sample", ka = "kon", kd = "koff")# Basic example: 5 variants with single measurements kinetic_data <- data.frame( id = c("WT", "Mut1", "Mut2", "Mut3", "Mut4"), ka = c(1.2e5, 2.5e5, 2e5, 8.0e4, 1.8e5), kd = c(1.5e-3, 2.0e-3, 1.5e-3, 1.2e-3, 1.8e-3) ) gg_kdmap(data = kinetic_data, show_anno = TRUE) # With replicates: lines connect points with same ID kinetic_rep <- data.frame( id = c("WT", "WT", "WT", "Mut1", "Mut1", "Mut2", "Mut3", "Mut4"), ka = c(1.2e5, 1.5e5, 1.1e5, 2.5e5, 2.4e5, 2e5, 8.0e4, 1.8e5), kd = c(1.5e-3, 1.6e-3, 1.4e-3, 2.0e-3, 1.9e-3, 1.5e-3, 1.2e-3, 1.8e-3) ) gg_kdmap(data = kinetic_rep, show_anno = TRUE, fill = "id") # Add labels and highlight reference gg_kdmap( data = kinetic_rep, labels = "id", ref_id = "WT", ref_fill = "white", ref_color = "red", fill = "id" ) # Customize iso-KD lines gg_kdmap( data = kinetic_rep, iso_n = 12, iso_color = "#7192ad", iso_type = "solid" ) # Turn off replicate lines gg_kdmap(data = kinetic_rep, rep_lines = FALSE) # Custom column names custom_data <- data.frame( sample = c("WT", "Mut1", "Mut2"), kon = c(1.2e5, 2.5e5, 5.0e4), koff = c(1.5e-3, 2.0e-3, 5.0e-4) ) gg_kdmap(data = custom_data, id = "sample", ka = "kon", kd = "koff")
Creates a three-panel visualization comparing ranks of samples between two groups. Left and right panels show distributions (bars or boxplots) for each group ordered by rank. The center panel displays connecting lines colored by rank change direction, revealing which samples improved, declined, or maintained their relative position.
gg_rankshift( data, id = "id", group = "group", value = "value", style = "box", fill = NULL, alpha = 0.7, line_alpha = 0.5, line_width = 0.5, panel_ratio = 0.5, text_size = 11, show_points = TRUE, point_size = 1, point_shape = 21, point_alpha = 0.7, stat_summary = "mean", decreasing = FALSE, free_x = TRUE, rank_change_colors = c(increase = "#d73027", decrease = "#4575b4", no_change = "grey50") )gg_rankshift( data, id = "id", group = "group", value = "value", style = "box", fill = NULL, alpha = 0.7, line_alpha = 0.5, line_width = 0.5, panel_ratio = 0.5, text_size = 11, show_points = TRUE, point_size = 1, point_shape = 21, point_alpha = 0.7, stat_summary = "mean", decreasing = FALSE, free_x = TRUE, rank_change_colors = c(increase = "#d73027", decrease = "#4575b4", no_change = "grey50") )
data |
A data frame containing the data to visualize. |
id |
Character string specifying the column name in |
group |
Character string specifying the column name in |
value |
Character string specifying the column name in |
style |
Character string specifying visualization type: |
fill |
Character vector of length 2 specifying fill colors for
the two groups. If NULL (default), uses |
alpha |
Numeric value (0-1) specifying transparency of bars/boxes. Default is 0.7. |
line_alpha |
Numeric value (0-1) specifying transparency of connecting lines. Default is 0.5. |
line_width |
Numeric value specifying width of connecting lines. Default is 0.3. |
panel_ratio |
Numeric value specifying the relative width of the center line panel compared to side panels (which have width 1). Default is 1. |
text_size |
Numeric value specifying the base size for axis text. Default is 11. |
show_points |
Logical indicating whether to overlay individual data points on bars/boxes. Default is TRUE. |
point_size |
Numeric value specifying size of points when
|
point_shape |
Numeric value (0-25) specifying point shape when
|
point_alpha |
Numeric value (0-1) specifying transparency of points when
|
stat_summary |
Character string specifying the summary statistic used
for ranking: |
decreasing |
Logical indicating rank order direction. If TRUE, higher values receive lower rank numbers (rank 1 = highest value). If FALSE, lower values receive lower rank numbers. Default is FALSE. |
free_x |
Logical indicating whether x-axes are independent between panels. If FALSE, both panels share the same x-axis limits. Default is TRUE. |
rank_change_colors |
Named character vector of length 3 specifying
colors for rank changes. Must contain names |
The function identifies samples common to both groups, calculates summary statistics (mean or median) for each sample within each group, and assigns ranks based on these values. Samples are then displayed in rank order with connecting lines showing how ranks changed between groups.
When style = "box" and show_points = TRUE, boxplots display
the distribution while individual points show all replicates. This is useful
for visualizing measurement variability alongside rank changes.
The decreasing parameter controls ranking direction:
FALSE (default): Rank 1 = lowest value, higher ranks =
higher values
TRUE: Rank 1 = highest value, lower ranks = lower values
A patchwork object combining three plots: left panel showing the first group's distribution, center panel showing rank change lines, and right panel showing the second group's distribution. Line colors indicate whether samples increased in rank (moved up), decreased in rank (moved down), or maintained the same rank between groups.
# Example data: bacterial strain growth rate control vs antibiotic treated growth_data <- data.frame( strain = rep(paste0("Strain", 1:13), each = 6), condition = rep(c("Control", "Treated"), each = 3, times = 13), growth_rate = c( rnorm(39, mean = 0.85, sd = 0.12), # Control rnorm(39, mean = 0.45, sd = 0.10) # Treated (reduced growth) ) ) # Basic rank shift plot gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", ) # With barplots instead of boxplots gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", style = "bar" ) # Custom styling gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", fill = c("#e41a1c", "#377eb8"), rank_change_colors = c( increase = "#1b9e77", decrease = "#d95f02", no_change = "#7570b3" ), panel_ratio = 0.5, point_size = 2.5, line_width = 1, decreasing = TRUE )# Example data: bacterial strain growth rate control vs antibiotic treated growth_data <- data.frame( strain = rep(paste0("Strain", 1:13), each = 6), condition = rep(c("Control", "Treated"), each = 3, times = 13), growth_rate = c( rnorm(39, mean = 0.85, sd = 0.12), # Control rnorm(39, mean = 0.45, sd = 0.10) # Treated (reduced growth) ) ) # Basic rank shift plot gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", ) # With barplots instead of boxplots gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", style = "bar" ) # Custom styling gg_rankshift( data = growth_data, id = "strain", group = "condition", value = "growth_rate", fill = c("#e41a1c", "#377eb8"), rank_change_colors = c( increase = "#1b9e77", decrease = "#d95f02", no_change = "#7570b3" ), panel_ratio = 0.5, point_size = 2.5, line_width = 1, decreasing = TRUE )
Plots sequences that are substrings of a reference sequence, with each unique sequence shown as a row at its aligned position. Useful for visualizing peptide mapping coverage, proteomics experiments, or any analysis where you need to show which parts of a reference sequence are covered by shorter sequences. Supports character coloring and region highlighting (e.g., CDRs, tags, binding sites).
gg_seq( data, ref, sequence = "sequence", name = NULL, color = NULL, highlight = NULL, wrap = NULL, size = 3, face = "plain", show_ref = TRUE, margin_t = 30, annotate = NULL, annotate_defaults = list(angle = 0, vjust = 0.5, size = 3, face = "plain", color = "black") )gg_seq( data, ref, sequence = "sequence", name = NULL, color = NULL, highlight = NULL, wrap = NULL, size = 3, face = "plain", show_ref = TRUE, margin_t = 30, annotate = NULL, annotate_defaults = list(angle = 0, vjust = 0.5, size = 3, face = "plain", color = "black") )
data |
A data frame containing sequences. |
ref |
Character string of the reference sequence against which sequences will be aligned. |
sequence |
Character string specifying the column name in |
name |
Character string specifying the column name in |
color |
Named character vector of colors for specific characters, or NULL
(default). If NULL, all characters are displayed in black. Characters specified
here are automatically displayed in bold. Example: |
highlight |
Named list where names are valid R colors and values are numeric
vectors of positions to highlight with vertical shading. The shading spans the
full height of the plot with semi-transparent color (alpha = 0.3) and black
borders. Consecutive positions are automatically merged into continuous bands.
To specify multiple regions with the same color, provide them as a single vector:
|
wrap |
Numeric value specifying the maximum number of positions to display
per row before wrapping to the next panel. If NULL (default), no wrapping is
applied and the entire sequence is displayed in a single row. When specified,
the plot is split into multiple vertically stacked panels, each showing up to
|
size |
Numeric value for the size of sequence characters. Default is 3. |
face |
Character string specifying font face for characters. Must be one of
"plain", "bold", "italic", or "bold.italic". Default is "plain". Note: Characters
specified in |
show_ref |
Logical indicating whether to show the reference sequence in the plot. Default is TRUE. |
margin_t |
Numeric value for the top margin in points. Increases space above the plot to prevent annotation clipping. Adjust this value upward if rotated annotations are cut off. Default is 30. |
annotate |
List of annotation specifications to add text labels above the plot.
Each element must be a list with required elements |
annotate_defaults |
List of default values for annotation styling. Valid
elements: |
A ggplot2 object showing the aligned sequences. The plot displays:
Character sequences aligned horizontally by their position in the reference
Each sequence on a separate row, ordered by starting position
Optional reference sequence at the top (if show_ref = TRUE)
Specified characters highlighted in bold with custom colors
Optional vertical shading bands at specified positions with black borders
Optional text annotations above the plot
If no sequences from data match the reference sequence, returns an empty
ggplot2 object with a warning message. Sequences that don't match the reference
are silently excluded from the plot without warning.
gg_seqdiff for visualizing sequence differences relative
to a reference.
# Create synthetic example of peptide mapping data # Reference sequence ref_seq <- paste0( "QVQLVESGGGLVQAGGSLRLSCAASGFTFSSYAMGWFRQAPGKEREFVAAINSGGST", "YYPDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLRGTTVNNYWGQGTQV", "TVSSEQKLISEEDL" ) # Peptides with RT and intensity df_peptides <- data.frame( id = c("Pep_1004", "Pep_1010", "Pep_1007", "Pep_1011", "Pep_1009", "Pep_1005", "Pep_1013", "Pep_1003", "Pep_1001", "Pep_1012", "Pep_1006", "Pep_1008", "Pep_1002"), sequence = c( "QAPGKER", "GRFTISR", "GTTVNNYWGQGTQVTVSSEQKLISEEDL", "GRFTISRDNAKNTVYLQMNSLK", "EREFVAAINSGGSTYYPDSVK", "QAPGKEREFVAAINSGGSTYYPDSVKGR", "NTVYLQMNSLKPEDTAVYYCAADLR", "LSCAASGFTFSSYAMGWFRQAPGKER", "QVQLVESGGGLVQAGGSLR", "PEDTAVYYCAADLRGTTVNNYWGQGTQVTVSSEQKLISEEDL", "FTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLR", "LSCAASGFTFSSYAMGWFRQAPGK", "LSCAASGFTFSSYAMGWFR" ), rt_min = c(10, 28.5, 34.4, 34.4, 36, 36.5, 40.8, 42.5, 42.8, 43.3, 44.1, 44.8, 46.7), intensity = c(2769840, 2248170, 2172370, 1698280, 2202810, 983267, 659246, 1064906, 1988932, 1438544, 639990, 1017811, 1112824), stringsAsFactors = FALSE ) # Base coverage map gg_seq(data = df_peptides, ref = ref_seq, wrap = 70) # With peptide IDs and residue coloring gg_seq( data = df_peptides, ref = ref_seq, name = "id", color = c(C = "red", K = "blue", R = "#468c2d"), highlight = list( "#ffb4b4" = c(27:33, 51:57, 96:107), "#70bcfa" = c(1, 43, 64, 75, 86) ), wrap = 70 ) # With annotations gg_seq( data = df_peptides, ref = ref_seq, name = "id", color = c(C = "red", K = "blue", R = "#468c2d"), highlight = list( "#ffb4b4" = c(27:33, 51:57, 96:107), # CDR regions "#70bcfa" = c(1, 43, 64, 75, 86), # Lysines "#d68718" = c(105:106), # Liability site "#94d104" = c(119:128) # c-Myc tag ), annotate = list( list(label = "CDR1", pos = 30), list(label = "CDR2", pos = 54), list(label = "CDR3", pos = 101), list(label = "N-term", pos = 1, angle = 90, vjust = 1), list(label = "K43", pos = 43, angle = 90), list(label = "K64", pos = 64, angle = 90), list(label = "K75", pos = 75, angle = 90), list(label = "K86", pos = 86, angle = 90), list(label = "Liability", pos = 106, angle = 90), list(label = "c-Myc tag", pos = 124) ), annotate_defaults = list(face = "bold"), wrap = 80 )# Create synthetic example of peptide mapping data # Reference sequence ref_seq <- paste0( "QVQLVESGGGLVQAGGSLRLSCAASGFTFSSYAMGWFRQAPGKEREFVAAINSGGST", "YYPDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLRGTTVNNYWGQGTQV", "TVSSEQKLISEEDL" ) # Peptides with RT and intensity df_peptides <- data.frame( id = c("Pep_1004", "Pep_1010", "Pep_1007", "Pep_1011", "Pep_1009", "Pep_1005", "Pep_1013", "Pep_1003", "Pep_1001", "Pep_1012", "Pep_1006", "Pep_1008", "Pep_1002"), sequence = c( "QAPGKER", "GRFTISR", "GTTVNNYWGQGTQVTVSSEQKLISEEDL", "GRFTISRDNAKNTVYLQMNSLK", "EREFVAAINSGGSTYYPDSVK", "QAPGKEREFVAAINSGGSTYYPDSVKGR", "NTVYLQMNSLKPEDTAVYYCAADLR", "LSCAASGFTFSSYAMGWFRQAPGKER", "QVQLVESGGGLVQAGGSLR", "PEDTAVYYCAADLRGTTVNNYWGQGTQVTVSSEQKLISEEDL", "FTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLR", "LSCAASGFTFSSYAMGWFRQAPGK", "LSCAASGFTFSSYAMGWFR" ), rt_min = c(10, 28.5, 34.4, 34.4, 36, 36.5, 40.8, 42.5, 42.8, 43.3, 44.1, 44.8, 46.7), intensity = c(2769840, 2248170, 2172370, 1698280, 2202810, 983267, 659246, 1064906, 1988932, 1438544, 639990, 1017811, 1112824), stringsAsFactors = FALSE ) # Base coverage map gg_seq(data = df_peptides, ref = ref_seq, wrap = 70) # With peptide IDs and residue coloring gg_seq( data = df_peptides, ref = ref_seq, name = "id", color = c(C = "red", K = "blue", R = "#468c2d"), highlight = list( "#ffb4b4" = c(27:33, 51:57, 96:107), "#70bcfa" = c(1, 43, 64, 75, 86) ), wrap = 70 ) # With annotations gg_seq( data = df_peptides, ref = ref_seq, name = "id", color = c(C = "red", K = "blue", R = "#468c2d"), highlight = list( "#ffb4b4" = c(27:33, 51:57, 96:107), # CDR regions "#70bcfa" = c(1, 43, 64, 75, 86), # Lysines "#d68718" = c(105:106), # Liability site "#94d104" = c(119:128) # c-Myc tag ), annotate = list( list(label = "CDR1", pos = 30), list(label = "CDR2", pos = 54), list(label = "CDR3", pos = 101), list(label = "N-term", pos = 1, angle = 90, vjust = 1), list(label = "K43", pos = 43, angle = 90), list(label = "K64", pos = 64, angle = 90), list(label = "K75", pos = 75, angle = 90), list(label = "K86", pos = 86, angle = 90), list(label = "Liability", pos = 106, angle = 90), list(label = "c-Myc tag", pos = 124) ), annotate_defaults = list(face = "bold"), wrap = 80 )
Visualizes mutations across aligned sequences by displaying only positions that differ from a reference sequence. Accepts either a data frame with sequences (which are aligned internally using Needleman-Wunsch global alignment) or a pre-aligned Clustal file. Supports character coloring and region highlighting (e.g., CDRs, tags, binding sites). Useful for focusing on differences in sequence comparisons. Inspired by Jalview's behavior when setting a reference sequence and hiding matching positions.
gg_seqdiff( data, ref, sequence = "sequence", name = NULL, clustal = NULL, color = NULL, highlight = NULL, wrap = NULL, size = 3, show_ref = TRUE, margin_t = 30, annotate = NULL, annotate_defaults = list(angle = 0, vjust = 0.5, size = 3, face = "plain", color = "black") )gg_seqdiff( data, ref, sequence = "sequence", name = NULL, clustal = NULL, color = NULL, highlight = NULL, wrap = NULL, size = 3, show_ref = TRUE, margin_t = 30, annotate = NULL, annotate_defaults = list(angle = 0, vjust = 0.5, size = 3, face = "plain", color = "black") )
data |
A data frame containing sequences. |
ref |
Character string of the reference sequence against which sequences will be aligned. |
sequence |
Character string specifying the column name in |
name |
Character string specifying the column name in |
clustal |
Character string specifying path to a Clustal alignment file.
If provided, overrides |
color |
Named character vector of colors for specific characters, or NULL
(default). If NULL, all characters are displayed in black. Characters specified
here are automatically displayed in bold. Example: |
highlight |
Named list where names are valid R colors and values are numeric
vectors of positions to highlight with vertical shading. The shading spans the
full height of the plot with semi-transparent color (alpha = 0.3) and black
borders. Consecutive positions are automatically merged into continuous bands.
To specify multiple regions with the same color, provide them as a single vector:
|
wrap |
Numeric value specifying the maximum number of positions to display
per row before wrapping to the next panel. If NULL (default), no wrapping is
applied and the entire sequence is displayed in a single row. When specified,
the plot is split into multiple vertically stacked panels, each showing up to
|
size |
Numeric value for the size of sequence characters. Default is 3. |
show_ref |
Logical indicating whether to show the reference sequence in the plot. Default is TRUE. |
margin_t |
Numeric value for the top margin in points. Increases space above the plot to prevent annotation clipping. Adjust this value upward if rotated annotations are cut off. Default is 30. |
annotate |
List of annotation specifications to add text labels above the plot.
Each element must be a list with required elements |
annotate_defaults |
List of default values for annotation styling. Valid
elements: |
The function aligns each sequence to the reference using Needleman-Wunsch global alignment, then displays only differences. Positions matching the reference are not displayed to reduce visual clutter and emphasize mutations. Gaps from alignment are also shown as dashes.
A ggplot2 object showing the aligned sequences with differences highlighted. The plot displays:
Each sequence on a separate row
Actual characters for positions that differ from the reference
Optional reference sequence at the top (if show_ref = TRUE)
Specified characters highlighted in bold with custom colors
Optional vertical shading bands at specified positions
Optional text annotations above the plot
If no valid sequences are found, returns an empty ggplot2 object with a message.
# ----------------------------------------------------------------------- # Example with Clustal alignment file # ----------------------------------------------------------------------- # Create a temporary Clustal file clustal_file <- tempfile(fileext = ".aln") writeLines(c( "CLUSTAL W (1.83) multiple sequence alignment", "", "WT EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "Mutant1 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "Mutant2 EQKLISEEDLMKTAYIAKQRQRSFVKSHFSRQLERIEKKWEAHFDDLHP", "Mutant3 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLER----IEAHFDDLHP", "Mutant4 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQAERIEKKIEAHFDDLHP", "Mutant5 EQKLISEEDLAKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDRHP", "Mutant6 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", " *********** ***************** * ******* *******:**", "", "WT DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant1 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant2 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant3 DIVALSGHTFGKTHGAGKQSS------", "Mutant4 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant5 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant6 DRVALSGHTFAKTHGAGKQSS------", " * ******** ********** " ), clustal_file) # Plot Clustal alignment gg_seqdiff( clustal = clustal_file, ref = paste0("EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "DIVALSGHTFGKTHGAGKQSSHHHHHH"), color = c(K = "#285bb8", R = "#285bb8", # Basic E = "#a12b20", D = "#a12b20", # Acidic W = "#9b59b6", F = "#9b59b6", # Aromatic H = "#f39c12"), # Histidine highlight = list( "#94d104" = 1:10, # N-terminal c-Myc tag "#FFE0B2" = 30:45, # Active site "#94d104" = 72:77 # C-terminal His-tag ), annotate = list( list(label = "c-Myc", pos = 5), list(label = "Active site", pos = 37), list(label = "6xHis", pos = 74) ), wrap = 60 ) # Clean up unlink(clustal_file) # ----------------------------------------------------------------------- # Example with DNA sequences - gene structure with regulatory elements # ----------------------------------------------------------------------- dna_ref <- paste0( "TATAAA", # TATA box (promoter) "ATGCGATCGATCGATCGTAGCTAGCT", # Exon 1 "GTAAGTATCGATCGAT", # Intron 1 (splice sites: GT...AG) "ACGTACGTACGTAGCTAGCTAGCTAC", # Exon 2 "GTACGTACGTACGTAC", # Intron 2 "GTACGTACGTAGCTAGCTAGCTACGT", # Exon 3 "ACGTACGTAAATAA" # 3'UTR with poly-A signal ) dna_df <- data.frame( sequence = c( dna_ref, sub("TATAAA", "TATATA", dna_ref), gsub("GTAAGT", "ATAAGT", dna_ref), gsub("CGATAG", "CGATAA", dna_ref), sub("ATG", "AAG", dna_ref), gsub("AATAA$", "AACAA", dna_ref), sub("GCGATCGATCGATCG", "GCGATCAATCGATCG", dna_ref), gsub("ACGTACGTACGTAG", "ACGTACATACGTAG", dna_ref) ), id = c("WT", "Promoter_mut", "Splice_donor", "Splice_acceptor", "Start_codon", "PolyA_mut", "Exon1_missense", "Exon2_frameshift") ) # Highlight gene structure elements gg_seqdiff( data = dna_df, ref = dna_ref, name = "id", color = c(G = "#4e8fb5", C = "#845cab"), highlight = list( "#FFE0B2" = 1:6, # TATA box (promoter) "#C8E6C9" = c(7:32, 49:74, 91:116), # Exons "#FFCCBC" = 117:130 # 3'UTR with poly-A ), annotate = list( list(label = "TATA", pos = 1, angle = 90), list(label = "ATG", pos = 7, angle = 90, color = "red"), list(label = "Exon1", pos = 19), list(label = "GT", pos = 33, angle = 90, size = 2.5), list(label = "GA", pos = 46, angle = 90, size = 2.5), list(label = "Exon2", pos = 61), list(label = "GT", pos = 75, angle = 90, size = 2.5), list(label = "AC", pos = 89, angle = 90, size = 2.5), list(label = "Exon3", pos = 103), list(label = "AATAAA", pos = 125, angle = 90, color = "blue") ), wrap = 80 ) # ----------------------------------------------------------------------- # Example with antibody sequences with CDR mutations # ----------------------------------------------------------------------- ref_seq <- paste0( "QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAINSGGSTYYP", "DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLRGTTVKDYWGQGTQVTVSSEQKLISEEDL" ) # All sequences must be same length as reference mutant_df <- data.frame( sequence = c( ref_seq, # Wild-type # CDR1 mutations (27-33) sub("GRTFSSYAMG", "GRTASSYAMG", ref_seq), # CDR2 mutations (51-57) sub("AINSGGS", "AINSAGS", ref_seq), # CDR3 mutations (96-107) sub("AADLRGTTVKDY", "AADLRGTTAKDY", ref_seq), # Framework mutations sub("QVQLVES", "EVQLVAS", ref_seq), # Multiple CDR mutations sub("AADLRGTTVKDY", "AADWRGTTVKDY", sub("GRTFSSYAMG", "GYTASSAAMG", ref_seq)) ), id = c("WT", "CDR1_F30A", "CDR2_G54A", "CDR3_V104A", "FR1_E5A", "CDR1+3_multi") ) # Highlight CDRs and tags, color key residues gg_seqdiff( data = mutant_df, ref = ref_seq, name = "id", color = c(R = "#285bb8", K = "#285bb8", # positive E = "#a12b20", D = "#a12b20", # negative W = "#9b59b6", F = "#9b59b6"), # aromatic highlight = list( "#70bcfa" = 1, # N-terminal "#ffb4b4" = c(27:33, 51:57, 96:107), # CDRs "#94d104" = 119:128 # c-Myc tag ), annotate = list( list(label = "N-term", pos = 1, angle = 90), list(label = "CDR1", pos = 30), list(label = "CDR2", pos = 54), list(label = "CDR3", pos = 102), list(label = "c-Myc", pos = 123) ), wrap = 66 )# ----------------------------------------------------------------------- # Example with Clustal alignment file # ----------------------------------------------------------------------- # Create a temporary Clustal file clustal_file <- tempfile(fileext = ".aln") writeLines(c( "CLUSTAL W (1.83) multiple sequence alignment", "", "WT EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "Mutant1 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "Mutant2 EQKLISEEDLMKTAYIAKQRQRSFVKSHFSRQLERIEKKWEAHFDDLHP", "Mutant3 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLER----IEAHFDDLHP", "Mutant4 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQAERIEKKIEAHFDDLHP", "Mutant5 EQKLISEEDLAKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDRHP", "Mutant6 EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", " *********** ***************** * ******* *******:**", "", "WT DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant1 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant2 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant3 DIVALSGHTFGKTHGAGKQSS------", "Mutant4 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant5 DIVALSGHTFGKTHGAGKQSSHHHHHH", "Mutant6 DRVALSGHTFAKTHGAGKQSS------", " * ******** ********** " ), clustal_file) # Plot Clustal alignment gg_seqdiff( clustal = clustal_file, ref = paste0("EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP", "DIVALSGHTFGKTHGAGKQSSHHHHHH"), color = c(K = "#285bb8", R = "#285bb8", # Basic E = "#a12b20", D = "#a12b20", # Acidic W = "#9b59b6", F = "#9b59b6", # Aromatic H = "#f39c12"), # Histidine highlight = list( "#94d104" = 1:10, # N-terminal c-Myc tag "#FFE0B2" = 30:45, # Active site "#94d104" = 72:77 # C-terminal His-tag ), annotate = list( list(label = "c-Myc", pos = 5), list(label = "Active site", pos = 37), list(label = "6xHis", pos = 74) ), wrap = 60 ) # Clean up unlink(clustal_file) # ----------------------------------------------------------------------- # Example with DNA sequences - gene structure with regulatory elements # ----------------------------------------------------------------------- dna_ref <- paste0( "TATAAA", # TATA box (promoter) "ATGCGATCGATCGATCGTAGCTAGCT", # Exon 1 "GTAAGTATCGATCGAT", # Intron 1 (splice sites: GT...AG) "ACGTACGTACGTAGCTAGCTAGCTAC", # Exon 2 "GTACGTACGTACGTAC", # Intron 2 "GTACGTACGTAGCTAGCTAGCTACGT", # Exon 3 "ACGTACGTAAATAA" # 3'UTR with poly-A signal ) dna_df <- data.frame( sequence = c( dna_ref, sub("TATAAA", "TATATA", dna_ref), gsub("GTAAGT", "ATAAGT", dna_ref), gsub("CGATAG", "CGATAA", dna_ref), sub("ATG", "AAG", dna_ref), gsub("AATAA$", "AACAA", dna_ref), sub("GCGATCGATCGATCG", "GCGATCAATCGATCG", dna_ref), gsub("ACGTACGTACGTAG", "ACGTACATACGTAG", dna_ref) ), id = c("WT", "Promoter_mut", "Splice_donor", "Splice_acceptor", "Start_codon", "PolyA_mut", "Exon1_missense", "Exon2_frameshift") ) # Highlight gene structure elements gg_seqdiff( data = dna_df, ref = dna_ref, name = "id", color = c(G = "#4e8fb5", C = "#845cab"), highlight = list( "#FFE0B2" = 1:6, # TATA box (promoter) "#C8E6C9" = c(7:32, 49:74, 91:116), # Exons "#FFCCBC" = 117:130 # 3'UTR with poly-A ), annotate = list( list(label = "TATA", pos = 1, angle = 90), list(label = "ATG", pos = 7, angle = 90, color = "red"), list(label = "Exon1", pos = 19), list(label = "GT", pos = 33, angle = 90, size = 2.5), list(label = "GA", pos = 46, angle = 90, size = 2.5), list(label = "Exon2", pos = 61), list(label = "GT", pos = 75, angle = 90, size = 2.5), list(label = "AC", pos = 89, angle = 90, size = 2.5), list(label = "Exon3", pos = 103), list(label = "AATAAA", pos = 125, angle = 90, color = "blue") ), wrap = 80 ) # ----------------------------------------------------------------------- # Example with antibody sequences with CDR mutations # ----------------------------------------------------------------------- ref_seq <- paste0( "QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAINSGGSTYYP", "DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLRGTTVKDYWGQGTQVTVSSEQKLISEEDL" ) # All sequences must be same length as reference mutant_df <- data.frame( sequence = c( ref_seq, # Wild-type # CDR1 mutations (27-33) sub("GRTFSSYAMG", "GRTASSYAMG", ref_seq), # CDR2 mutations (51-57) sub("AINSGGS", "AINSAGS", ref_seq), # CDR3 mutations (96-107) sub("AADLRGTTVKDY", "AADLRGTTAKDY", ref_seq), # Framework mutations sub("QVQLVES", "EVQLVAS", ref_seq), # Multiple CDR mutations sub("AADLRGTTVKDY", "AADWRGTTVKDY", sub("GRTFSSYAMG", "GYTASSAAMG", ref_seq)) ), id = c("WT", "CDR1_F30A", "CDR2_G54A", "CDR3_V104A", "FR1_E5A", "CDR1+3_multi") ) # Highlight CDRs and tags, color key residues gg_seqdiff( data = mutant_df, ref = ref_seq, name = "id", color = c(R = "#285bb8", K = "#285bb8", # positive E = "#a12b20", D = "#a12b20", # negative W = "#9b59b6", F = "#9b59b6"), # aromatic highlight = list( "#70bcfa" = 1, # N-terminal "#ffb4b4" = c(27:33, 51:57, 96:107), # CDRs "#94d104" = 119:128 # c-Myc tag ), annotate = list( list(label = "N-term", pos = 1, angle = 90), list(label = "CDR1", pos = 30), list(label = "CDR2", pos = 54), list(label = "CDR3", pos = 102), list(label = "c-Myc", pos = 123) ), wrap = 66 )
Creates a split-correlation plot where the upper triangle shows correlations for one subgroup and the lower triangle for another, based on a binary splitting variable. This allows quick visual comparison of correlation structures between two groups. Significant correlations (after multiple testing adjustment) can be labeled directly in the plot.
gg_splitcorr( data, split, style = "tile", method = "pearson", padjust = "BH", use = "complete.obs", colors = c("blue", "white", "red"), text_colors = c("white", "black"), text_size = 3.5, border_color = "black", prefix = NULL, linetype = "dashed", linealpha = 0.5, offset = 0.75 )gg_splitcorr( data, split, style = "tile", method = "pearson", padjust = "BH", use = "complete.obs", colors = c("blue", "white", "red"), text_colors = c("white", "black"), text_size = 3.5, border_color = "black", prefix = NULL, linetype = "dashed", linealpha = 0.5, offset = 0.75 )
data |
A data frame containing numeric variables to correlate and the variable to split by. |
split |
A character string specifying the name of the binary variable
in |
style |
Type of visualization; either |
method |
Correlation method to use; either |
padjust |
Method for p-value adjustment, passed to
|
use |
Handling of missing values, passed to
|
colors |
A vector of three colors for the low, mid, and high values
of the correlation scale (default |
text_colors |
A vector of two colors for the text labels, used for
negative and positive correlations (default |
text_size |
Numeric value giving the size of correlation text labels
(default |
border_color |
Color for tile or point borders (default |
prefix |
Character string prefix for group labels. If NULL (default), uses "split_variable = " format. Default is NULL. |
linetype |
Type of diagonal line separating upper and lower triangles;
one of |
linealpha |
Alpha transparency for the diagonal line (default |
offset |
Numeric offset for the position of the group labels (default |
The function:
Splits the dataset into two groups using the variable specified by split.
Computes pairwise correlations and p-values for each group (via a helper cor_p()).
Combines the upper triangle from one group and lower triangle from the other.
Adjusts p-values using the selected method and annotates significant cells.
The result is a heatmap (or bubble plot) showing both groups' correlation patterns in a single compact visualization.
A ggplot2 object showing the split-correlation heatmap. The plot displays:
Upper triangle: correlations for the first level of the split variable
Lower triangle: correlations for the second level of the split variable
Diagonal line separating the two triangles
Group labels indicating which split level is shown in each triangle
Correlation values displayed only for significant pairs (p ≤ 0.05 after adjustment)
Color gradient representing correlation strength (-1 to 1)
Optional point size (if style = "point") indicating absolute correlation strength
cor for correlation computation,
p.adjust for multiple testing correction,
geom_tile,
geom_point
# Compare correlations between V-shaped vs straight engines data(mtcars) gg_splitcorr( data = mtcars, split = "vs", prefix = "Engine Type: " ) # Alternative style "point" gg_splitcorr( data = mtcars, split = "vs", style = "point", method = "spearman", prefix = "Engine Type: " )# Compare correlations between V-shaped vs straight engines data(mtcars) gg_splitcorr( data = mtcars, split = "vs", prefix = "Engine Type: " ) # Alternative style "point" gg_splitcorr( data = mtcars, split = "vs", style = "point", method = "spearman", prefix = "Engine Type: " )